PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v2238710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 556aa    MW: 62581.9 Da    PI: 5.8847
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v2238710.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-093493861954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  Lj5g3v2238710.1 349 FEHflHPYPKDSEKIMLARQTGLTRNQVANWFINARVR 386
                      665559******************************88 PP

2BELL118.72.6e-38220291172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erq+l  kk+kLls+l+eVdkrY+ y++q+q+v+ss ++vag+g+a+pYt+lAl++iSrhFrcL+dai++qi
  Lj5g3v2238710.1 220 ERQNLLDKKTKLLSMLDEVDKRYRLYCHQMQIVVSSLDMVAGCGAAEPYTTLALRTISRHFRCLRDAISSQI 291
                      6899999****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.7E-58139289IPR006563POX domain
PfamPF075262.1E-49144288IPR006563POX domain
PROSITE profilePS5007112.438327390IPR001356Homeobox domain
CDDcd000868.29E-12330391No hitNo description
SMARTSM003891.6E-9330394IPR001356Homeobox domain
SuperFamilySSF466893.29E-17331396IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-28333395IPR009057Homeodomain-like
PfamPF059202.6E-17347386IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MYSDHAFSSW SYAEMLSGGS LLPHNYAESV GGSQNEEQNM QCQGLSLSLG TVMPSAGSVP  60
QFQYQYPDTG FLPLLNSFVP NMKGTMSIKD DETNLHKELR SAESMASVSS EGFHDMIKRE  120
GFYNQHPSIC SNPCLQGSQG FSNIVQNSRY LKAAQELLDE VVSVRKALKQ SGMEKQENFR  180
DVGLDGSKGS DGKSTSQSVQ ISSGPNGSSA NPSCELSSAE RQNLLDKKTK LLSMLDEVDK  240
RYRLYCHQMQ IVVSSLDMVA GCGAAEPYTT LALRTISRHF RCLRDAISSQ IQVAQRNLGE  300
QEGIPRLRYV DQQLRQQKAL QQLGVMRQAW RPQRGLPESS VSILRAWLFE HFLHPYPKDS  360
EKIMLARQTG LTRNQVANWF INARVRLWKP MVEEIYKEEI GDSEIMKCNL SSENTLKGKR  420
DGVQESNNKW EESQDNSIAV DNNSIQLEHA SSNTEENVMD SETRKLQGNQ RFSLYSMSQM  480
DSTPATTYDD DISLALELRN CESDGFGIVD DAMHKRRNQT LASSPETDLL DYHFTDSGKQ  540
QHSRFSNPHL MHEFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-16336393158Homeobox protein Meis1
4xrs_B3e-16336393158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.178870.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1481290.0BT148129.1 Lotus japonicus clone JCVI-FLLj-21A22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595919.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_006595918.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A151TC660.0A0A151TC66_CAJCA; BEL1-like homeodomain protein 7
STRINGGLYMA14G07710.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21463179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-102BEL1-like homeodomain 3